- Troponin T Type 3 (fast skeletal) Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-92534
- DA2B2, TNTF, beta-TnTF
- Rabbit
- This antibody was developed against Recombinant Protein corresponding to amino acids: RKPLNIDHLG EDKLRDKAKE LWETLHQLEI DKFEFGEKLK RQKYDITTLR SRIDQAQKHS KKAGTPAKGK VG
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- 0.1 ml (also 25ul)
- Human
- Troponin T Type 3 (fast skeletal)
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- troponin T3, fast skeletal type
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Apoptosis, Cell Biology, Cellular Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
RKPLNIDHLGEDKLRDKAKELWETLHQLEIDKFEFGEKLKRQKYDITTLRSRIDQAQKHSKKAGTPAKGKVG
Specifications/Features
Available conjugates: Unconjugated